PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc033582.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 174aa    MW: 19364.7 Da    PI: 4.7595
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc033582.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK72.84.3e-23111159452
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              ++s e++s yF++p+ ++A eLg++ T+LK +C + GI+RWPhRk+ksl
  Itr_sc033582.1_g00001.1 111 TLSREVISIYFHMPVCQVAEELGIGETTLKERCKKVGIPRWPHRKLKSL 159
                              7899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.4594174IPR003035RWP-RK domain
PfamPF020422.1E-19112159IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MESPSSSLCN LEYEVTSSSF SNLIDCPVLG YSLWDRHLFM PDSCFEVTPA TELFHDSLSP  60
ISPTDTEQSH NGIQGCSDDT SVESSEVGEV TIVEDSSSKK EGRARRPVPS TLSREVISIY  120
FHMPVCQVAE ELGIGETTLK ERCKKVGIPR WPHRKLKSLE ALMKNVQVYS FNSS
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.11e-22RWP-RK domain-containing protein